Mazdutide Peptide – Research Grade Dual GLP-1/Glucagon Receptor Agonist
Product Overview
Mazdutide (also known as IBI-362) is a synthetic long-acting peptide related to mammalian oxyntomodulin (OXM), modified with a fatty acid side chain to prolong its duration of action and allow once-weekly administration . It functions as a balanced dual agonist of the glucagon-like peptide-1 receptor (GLP-1R) and the glucagon receptor (GCGR) .
Mazdutide received its first approval in June 2025 in China for long-term body weight management in adults with obesity or overweight . In September 2025, it received additional approval in China for glycemic control in adults with type 2 diabetes .
⚠️ Research Context: This product is intended exclusively for in-vitro and laboratory research purposes.
Mechanism of Action
Mazdutide functions through a unique “dual metabolic engine” mechanism by activating both GLP-1 and glucagon receptors :
GLP-1 Receptor Activation:
-
Suppresses appetite and slows gastric emptying
-
Enhances insulin secretion and improves glycemic control
Glucagon Receptor Activation:
-
Increases energy expenditure and basal metabolic rate
-
Promotes fatty acid oxidation and hepatic fat breakdown
-
Reduces liver fat accumulation
Dual Synergy:
-
The combination produces greater weight loss than GLP-1 monotherapy by reducing energy intake while increasing energy expenditure
-
Activates multiple signaling pathways including cAMP signaling (hsa04024) and insulin secretion pathways (hsa04911)
Key Research Applications:
-
Metabolic regulation and energy homeostasis studies
-
Adipose tissue metabolism and hepatic steatosis research
-
Glucose metabolism and insulin sensitivity investigations
-
Cardiometabolic risk factor research
-
GLP-1/glucagon receptor co-agonism pharmacology
Product Specifications
| Parameter | Specification |
|---|---|
| Product Name | Mazdutide |
| Synonyms | IBI-362, LY-3305677, OXM-3 |
| CAS Number | 2259884-03-0 |
| Molecular Formula | C₂₁₀H₃₂₂N₄₆O₆₇ |
| Molecular Weight | ~4563.07 g/mol (or ~3142.6 Da for variant) |
| Sequence (One Letter) | HXQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG |
| Type | Modified Peptide / Oxyntomodulin Analog |
| Purity | ≥99% (HPLC Verified) |
| Form | White to off-white lyophilized powder |
| Endotoxin Level | <0.25 EU/mg |
| Storage | -20°C (long-term); -80°C for extended storage; protected from light, desiccated |
| Solubility | Soluble in water; pH adjustment to 2 with HCl |
| Shipping | On dry ice |
Research Background
Clinical Trial Evidence
Phase III GLORY-1 Trial Results :
| Parameter | Mazdutide 4mg | Mazdutide 6mg | Placebo |
|---|---|---|---|
| Weight Loss (48 weeks) | ~12% | ~14.8% | ~0.5% |
| Waist Circumference Reduction | -9.48 cm | -10.96 cm | -1.48 cm |
| Participants Achieving ≥15% Weight Loss | ~50% | ~50% | Low |
Meta-Analysis Data :
-
Weight Loss: Mean reduction of -12.42% body weight (95% CI: -16.15% to -8.68%)
-
Absolute Weight Loss: -9.76 kg (95% CI: -13.15 to -6.37 kg)
-
HbA1c Reduction: -0.63% (95% CI: -0.82 to -0.44) in T2DM patients
-
Systolic Blood Pressure: -7.68 mmHg reduction
-
LDL Cholesterol: -0.37 mmol/L reduction
Liver Fat Reduction:
-
Mazdutide 6mg demonstrated an 80.2% reduction in liver fat content in participants with elevated liver fat at baseline, compared to only 5.3% reduction with placebo .
Safety Profile
The most common adverse events are gastrointestinal side-effects, including nausea, vomiting, and diarrhea, which are typically mild to moderate and occur during dose escalation phases . Serious adverse events are rare, and discontinuation rates due to adverse events are low (1.5% for 4mg, 0.5% for 6mg, vs. 1% for placebo) .
Storage & Reconstitution Guidelines
Storage Conditions:
-
Lyophilized (Long-term): -20°C (or -80°C for extended storage), protected from light, desiccated, inert gas charged
-
Lyophilized (Short-term): 2°C – 8°C (refrigerated)
-
Reconstituted: 4°C for up to 7 days; aliquot for extended storage; avoid repeated freeze-thaw cycles
Reconstitution Protocol:
-
Allow vial to reach room temperature
-
Add sterile bacteriostatic water (ultrasonic and adjust pH to 2 with HCl may be needed for complete dissolution)
-
Gently swirl (do not vortex) until fully dissolved
-
Dispense into individual aliquots to minimize freeze-thaw degradation
Note: Peptides are sensitive to formulation, process, and environmental conditions that may lead to aggregation and degradation.
Important Notice
⚠️ FOR RESEARCH USE ONLY
This product is not intended for human consumption, diagnostic use, therapeutic application, or clinical administration. Mazdutide is a research chemical intended exclusively for in-vitro and laboratory research purposes.
-
Not a dietary supplement, food additive, or pharmaceutical for over-the-counter purchase
-
Not approved by the FDA for human use outside of regulated prescription settings (approved in China for clinical use)
-
Intended solely for qualified researchers and scientific institutions
By purchasing this product, you confirm that you are a licensed researcher or laboratory professional and agree to use this compound in compliance with all applicable local, national, and international regulations.
Why Choose PeptidesUnit.com?
| Feature | Benefit |
|---|---|
| ✅ Premium Purity | ≥99% HPLC-verified purity guaranteed |
| ✅ Research-Grade Quality | Manufactured under GMP-aligned conditions |
| ✅ Third-Party Tested | Independent COA for every batch |
| ✅ Secure Packaging | Lyophilized in amber glass vials with tamper-evident seals |
| ✅ Fast Global Shipping | Discreet packaging with real-time tracking |
| ✅ Competitive Pricing | Direct-from-manufacturer pricing |
Order Now
Mazdutide Peptide 5mg – ≥99% Purity
Available for immediate shipment






Dr. Mark Sullivan –
I’ve been ordering research peptides from PeptidesUnit for over a year now and their consistency is unmatched. The purity and quality are always top-notch
Sarah Mitchell –
Absolutely thrilled with my order from PeptidesUnit. The peptides arrived quickly
James Rodriguez –
Really satisfied with PeptidesUnit’s products. The shipping was prompt and the peptides were exactly as described. Giving 4 stars only because I wish they offered more payment options
Emily Chen –
PeptidesUnit is my go-to source for research materials. Their prices are competitive
David Wilson –
I was a bit skeptical ordering online at first
Laura Martinez –
Good experience overall with PeptidesUnit. The product quality is great and shipping was fast. Giving 4 stars because I had a minor issue with the vial packaging
Robert Taylor –
I’ve tried several peptide suppliers and PeptidesUnit is by far the best. Their quality control is evident in every product. The peptides are pure
Amanda White –
PeptidesUnit made my first research purchase so easy. Their website is user-friendly
Kevin Brown –
I’ve been a loyal customer for several months now and PeptidesUnit has never disappointed. The quality is consistently excellent and their shipping is lightning fast. They are a trustworthy and reliable supplier. Highly recommend!
Jessica Lee –
Very happy with my purchase from PeptidesUnit. The product quality is excellent and the price is reasonable. Giving 4 stars because the tracking information could be more detailed
Daniel Miller –
PeptidesUnit is a game-changer for researchers. Their peptides are of the highest purity and their customer service is second to none. I’ve recommended them to all my colleagues. Excellent company!
Michelle Garcia –
I’m so glad I found PeptidesUnit. Their products are fantastic and their shipping is always on time. They make ordering research materials so simple and stress-free. Highly recommended for anyone in the field!
Brian Martinez –
Really solid experience with PeptidesUnit. The product quality is top-tier and the order arrived promptly. Giving 4 stars because the website could be a bit more modern
Nicole Anderson –
PeptidesUnit exceeded all my expectations. The quality of their peptides is amazing and their customer service team is incredibly helpful and friendly. I will never use another supplier. Five stars all the way!
Jason Thomas –
I’ve ordered multiple times from PeptidesUnit and every single order has been perfect. Their peptides are high-quality
Rachel Kim –
Great products and fast shipping from PeptidesUnit. I’m very satisfied with my order. Giving 4 stars because the packaging could be a bit more discreet
Steven Park –
PeptidesUnit is simply the best. Their commitment to quality and customer satisfaction is unmatched. Every order I’ve placed has arrived quickly and in perfect condition. I couldn’t be happier with their service!
Jennifer Davis –
I recently started using PeptidesUnit for my research and I’m thoroughly impressed. The peptides are pure and effective
Christopher Wilson –
This was my first time ordering from PeptidesUnit and I was blown away by the quality and service. The products arrived very quickly and the customer support was outstanding. I will definitely be a returning customer!
Ashley Moore –
Very good experience with PeptidesUnit. The product quality is excellent and the shipping was fast. Giving 4 stars because I wish they offered a loyalty program for repeat customers
Matthew Taylor –
PeptidesUnit is my absolute favorite supplier. Their peptides are always high-quality
Stephanie White –
I’ve been using PeptidesUnit for my research needs for a while now and they never disappoint. The quality is consistently excellent and their customer service is top-notch. Highly recommend them to anyone looking for quality peptides!
Andrew Harris –
Really pleased with my order from PeptidesUnit. The product arrived quickly and the quality was great. Giving 4 stars because the communication about the order status could be improved
Laura Martin –
PeptidesUnit is fantastic! Their products are of the highest quality and their shipping is super fast. I’ve never had any issues with them and they always deliver on their promises. Highly recommended!
Gregory Nelson –
I’ve used many peptide suppliers
Megan O’Brien –
Great experience with PeptidesUnit. The product quality is excellent and the shipping was fast and secure. Giving 4 stars because I wish they had a wider selection of peptides
Ryan Murphy –
PeptidesUnit is hands down the best peptide supplier out there. Their quality is unmatched
Olivia Carter –
I’m very impressed with PeptidesUnit. Their products are amazing and they always arrive on time. The ordering process is simple and their team is very professional. Highly recommended for all your research needs!
Tyler Adams –
Very satisfied with my purchase from PeptidesUnit. The product quality is excellent and the price is reasonable. Giving 4 stars because the packaging could be more secure
Brittany Foster –
PeptidesUnit is my trusted source for research peptides. Their quality is consistently outstanding and their shipping is always reliable. I’ve never been disappointed with them. Highly recommend!
Nathan Reed –
I recently discovered PeptidesUnit and I’m so glad I did. Their products are top-quality and their customer service is excellent. They answered all my questions promptly and my order arrived very quickly. Five stars!
Chelsea Cox –
Really good experience with PeptidesUnit. The product quality is great and the shipping was fast. Giving 4 stars because the website could be more intuitive
Derek Powell –
PeptidesUnit is the only supplier I trust for my research. Their quality is superb
Hannah Ward –
I can’t say enough good things about PeptidesUnit. Their products are amazing and they always deliver on time. Their customer service team is also very helpful and responsive. Truly a top-tier supplier!
Eric Simmons –
Very happy with my order from PeptidesUnit. The product quality is excellent and the shipping was prompt. Giving 4 stars because I think they could improve their packaging for better protection
Vanessa Ross –
PeptidesUnit is my favorite peptide supplier. Their products are always high-quality and their shipping is lightning fast. They are incredibly reliable and I trust them completely with my research needs. Highly recommend!
Keith Flores –
I’ve ordered from PeptidesUnit several times and they have never let me down. Their quality is consistently outstanding and their customer service is excellent. They are definitely the best in the business. Five stars!
Kimberly Coleman –
Great experience with PeptidesUnit overall. The product quality is fantastic and the shipping was fast. Giving 4 stars because I wish they offered overnight shipping options
Jonathan Hayes –
PeptidesUnit is absolutely fantastic! Their products are of the highest quality and their service is impeccable. I’ve recommended them to all my friends and colleagues. If you’re looking for quality peptides