Sermorelin Peptide – Research Grade GHRH Analog
Product Overview
Sermorelin Peptide is a synthetic 29-amino acid peptide (GRF 1-29 NH₂) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH), which consists of 44 amino acid residues . This N-terminal sequence is identical in several mammalian species, including human, pig, and cattle .
Sermorelin Peptide was originally FDA-approved in 1990 for diagnostic evaluation of pituitary function and for the treatment of growth hormone deficiency in children . The brand product was discontinued in 2008, but the compound remains a research-grade peptide for endocrine and metabolic studies .
⚠️ Research Context: This product is intended exclusively for in-vitro and laboratory research purposes. It is not approved by the FDA for over-the-counter human use.

Mechanism of Action
Sermorelin Peptide functions as a GHRH receptor agonist :
-
GHRH Receptor Binding: Binds to the growth hormone-releasing hormone receptor on pituitary somatotroph cells, mimicking native GRF in its ability to stimulate growth hormone secretion
-
Pituitary Stimulation: Increases plasma growth hormone (GH) concentration by stimulating the pituitary gland to release GH
-
Physiological GH Release: Stimulates growth hormone secretion in a pulsatile pattern, preserving natural hormonal feedback mechanisms
-
IGF-1 Mediation: The released GH signals the liver to produce insulin-like growth factor 1 (IGF-1), the main mediator of GH’s positive effects
Key Research Applications:
-
Growth hormone axis and GHRH receptor signaling studies
-
Pituitary function and endocrine regulation research
-
Metabolic and body composition investigations
-
Aging and age-related GH decline research
Product Specifications
| Parameter | Specification |
|---|---|
| Product Name | Sermorelin |
| Synonyms | GRF 1-29 NH₂, GHRH(1-29)NH₂, Somatoliberin, Geref® |
| CAS Number | 86168-78-7 |
| Molecular Formula | C₁₄₉H₂₄₆N₄₄O₄₂S |
| Molecular Weight | 3,357.9 g/mol |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQ |
| Length | 29 Amino Acids |
| Isoelectric Point | 9.99 |
| Half-Life | 11-12 minutes |
| Purity | ≥99% (HPLC Verified) |
| Appearance | White to off-white lyophilized powder |
| Endotoxin Level | <0.25 EU/mg |
| Storage | -20°C (long-term); 2-8°C (short-term), protected from light and moisture |
Quality Assurance
Every batch of Sermorelin undergoes rigorous analytical testing to ensure maximum purity and research integrity:
| Test | Method | Specification |
|---|---|---|
| Identity | ESI-MS / HPLC | Matches theoretical mass |
| Purity | RP-HPLC | ≥99% area |
| Sequence Confirmation | MS/MS | 100% sequence coverage |
| Endotoxin | LAL Test | <0.25 EU/mg |
| Sterility | USP <71> | No growth |
Certificate of Analysis (COA) available upon request.

Research Background
Pharmacodynamics & Mechanism
Sermorelin is similar to the full-length native hormone (44 residues) in its ability to stimulate GH secretion in humans . It binds to the GHRH receptor on the anterior pituitary to trigger GH release, functioning as a hormone stimulant that activates endogenous growth hormone production rather than delivering synthetic hormone directly . Sermorelin Peptide
Clinical & Regulatory Status
-
FDA Status: Approved in 1990 for diagnostic evaluation of pituitary function and pediatric growth hormone deficiency
-
Market Status: Brand product discontinued in 2008
-
Primary Use (Historical): Treatment of children with growth hormone deficiency and growth failure
-
Off-Label Research Context: Investigated for acute or age-related growth hormone insufficiency
Research Considerations
Sermorelin is one of the few authorized peptides in its class, but the original product was withdrawn from the market due to commercial reasons . It remains a compound of interest in endocrine research and aging studies. Sermorelin Peptide
Storage & Reconstitution Guidelines
Storage Conditions:
-
Lyophilized (Long-term): -20°C, protected from light, dry, sealed
-
Lyophilized (Short-term): 2°C – 8°C (refrigerated)
-
Reconstituted: 4°C for up to 7 days; aliquot and store at -20°C for extended storage; avoid repeated freeze-thaw cycles
Reconstitution Protocol:
-
Allow vial to reach room temperature
-
Add sterile bacteriostatic water or 0.9% sodium chloride solution
-
Gently swirl (do not vortex) until fully dissolved
-
Dispense into individual aliquots to minimize freeze-thaw degradation
Note: Peptides are sensitive to formulation, process, and environmental conditions that may lead to aggregation and degradation. Sermorelin Peptide
Important Notice
⚠️ FOR RESEARCH USE ONLY
This product is not intended for human consumption, diagnostic use, therapeutic application, or clinical administration. Sermorelin Peptide is a research chemical intended exclusively for in-vitro and laboratory research purposes.
-
Not approved by the FDA for over-the-counter human use
-
Not a dietary supplement, food additive, or pharmaceutical for over-the-counter purchase
-
Intended solely for qualified researchers and scientific institutions
By purchasing this product, you confirm that you are a licensed researcher or laboratory professional and agree to use this compound in compliance with all applicable local, national, and international regulations. sermorelin peptide therapy
Why Choose PeptidesUnit.com?
| Feature | Benefit |
|---|---|
| ✅ Premium Purity | ≥99% HPLC-verified purity guaranteed |
| ✅ Research-Grade Quality | Manufactured under GMP-aligned conditions |
| ✅ Third-Party Tested | Independent COA for every batch |
| ✅ Secure Packaging | Lyophilized in amber glass vials with tamper-evident seals |
| ✅ Fast Global Shipping | Discreet packaging with real-time tracking |
| ✅ Competitive Pricing | Direct-from-manufacturer pricing |
Order Now
Sermorelin Peptide 5mg – ≥99% Purity
Available for immediate shipment Sermorelin Peptide
🛒 BUY NOW at PeptidesUnit.com
For bulk orders (10+ vials), custom peptide synthesis, or wholesale inquiries, please contact our sales team at sales@peptidesunit.com. Buy Sermorelin Peptide





Reviews
There are no reviews yet