Cagrilintide Peptide 5mg / 10mg (≥99% Purity) – Research Grade Long-Acting Amylin Analog
Cagrilintide Peptide Overview
Cagrilintide Peptide is an investigational long-acting acylated peptide analogue of amylin, a neuroendocrine hormone co-secreted with insulin by pancreatic beta-cells in response to food intake. As a non-selective agonist of amylin receptors (AMYRs) and the calcitonin G protein-coupled receptor (CTR), cagrilintide represents a novel therapeutic class for metabolic research.
The peptide incorporates a fatty acid acylation modification that enables binding to serum albumin, significantly extending its half-life compared to native amylin or earlier analogs such as pramlintide. Cagrilintide is currently in clinical development for weight management and type-2 diabetes, including in fixed-dose combination with semaglutide (CagriSema).
Mechanism of Action
Cagrilintide functions through the activation of amylin receptor subtypes (AMY1-3), which are heterodimers formed by the calcitonin receptor (CTR) and receptor activity-modifying proteins (RAMPs). This signaling pathway regulates:
-
Appetite Suppression: Reduces food intake through central mechanisms in brain regions associated with energy homeostasis
-
Gastric Emptying: Modulates gastrointestinal motility
-
Energy Homeostasis: Influences metabolic regulation and energy expenditure
Key Research Applications:
-
Amylin receptor signaling and pathway studies
-
Metabolic regulation and energy homeostasis research
-
Appetite and satiety mechanism investigations
-
Combination therapy research with GLP-1 analogs
-
Obesity and type-2 diabetes preclinical models
Cagrilintide Peptide Product Specifications
| Parameter | Specification |
|---|---|
| Product Name | Cagrilintide |
| Synonyms | 0174-0833, AMYR/CTR agonist |
| CAS Number | 1415456-99-3 (free base) |
| Molecular Formula | C₁₉₄H₃₁₂N₅₄O₅₉S₂ |
| Molecular Weight | 4409.01 g/mol |
| Sequence | {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (Disulfide bridge: Cys3-Cys8) |
| Purity | ≥99% (by HPLC area) |
| Form | White to off-white lyophilized powder |
| Peptide Content | ≥70% |
| Water Content | ≤5.0% |
| Endotoxin Level | <0.25 EU/mg |
| Storage | -20°C, protected from light, dry, sealed |
Quality Assurance
Every batch of Cagrilintide undergoes comprehensive analytical testing to ensure maximum purity and research integrity:
| Test | Method | Specification |
|---|---|---|
| Identity | ESI-MS | Matches theoretical mass |
| Purity | RP-HPLC | ≥99% area |
| Sequence Confirmation | MS/MS | 100% sequence coverage |
| Disulfide Bridge | NEM blocking | Confirmed Cys3-Cys8 formation |
| Endotoxin | LAL Test | <0.25 EU/mg |
Certificate of Analysis (COA) available upon request.
Storage & Reconstitution Guidelines
Storage Conditions:
-
Lyophilized (Long-term): -20°C, protected from light and moisture
-
Lyophilized (Short-term): 2°C – 8°C (refrigerated)
-
Reconstituted: 4°C for up to 7 days; avoid repeated freeze-thaw cycles
Reconstitution Protocol:
-
Allow vial to reach room temperature
-
Add sterile bacteriostatic water or 0.9% sodium chloride solution
-
Gently swirl (do not vortex) until fully dissolved
-
Allow solution to stand at 4°C for complete reconstitution
Note: Peptides are sensitive to formulation, process, and environmental conditions that may lead to aggregation and degradation. Cagrilintide Peptide
Important Notice
⚠️ FOR RESEARCH USE ONLY
This product is not intended for human consumption, diagnostic use, therapeutic application, or clinical administration. Cagrilintide is a research chemical intended exclusively for in-vitro and laboratory research purposes.
-
Not approved by the FDA for human use
-
Not a dietary supplement, food additive, or pharmaceutical
-
Intended solely for qualified researchers and scientific institutions
By purchasing this product, you confirm that you are a licensed researcher or laboratory professional and agree to use this compound in compliance with all applicable local, national, and international regulations. Cagrilintide Peptide
Why Choose PeptidesUnit.com?
| Feature | Benefit |
|---|---|
| ✅ Premium Purity | ≥99% HPLC-verified purity guaranteed |
| ✅ Research-Grade Quality | Manufactured under GMP-aligned conditions |
| ✅ Third-Party Tested | Independent COA for every batch |
| ✅ Secure Packaging | Lyophilized in amber glass vials with tamper-evident seals |
| ✅ Fast Global Shipping | Discreet packaging with real-time tracking |
| ✅ Competitive Pricing | Direct-from-manufacturer pricing |
Order Now
Cagrilintide Peptide 5mg – ≥99% Purity
Available for immediate shipment





Reviews
There are no reviews yet