Mazdutide Peptide – Research Grade Dual GLP-1/Glucagon Receptor Agonist
Product Overview
Mazdutide (also known as IBI-362) is a synthetic long-acting peptide related to mammalian oxyntomodulin (OXM), modified with a fatty acid side chain to prolong its duration of action and allow once-weekly administration . It functions as a balanced dual agonist of the glucagon-like peptide-1 receptor (GLP-1R) and the glucagon receptor (GCGR) .
Mazdutide received its first approval in June 2025 in China for long-term body weight management in adults with obesity or overweight . In September 2025, it received additional approval in China for glycemic control in adults with type 2 diabetes .
⚠️ Research Context: This product is intended exclusively for in-vitro and laboratory research purposes.
Mechanism of Action
Mazdutide functions through a unique “dual metabolic engine” mechanism by activating both GLP-1 and glucagon receptors :
GLP-1 Receptor Activation:
-
Suppresses appetite and slows gastric emptying
-
Enhances insulin secretion and improves glycemic control
Glucagon Receptor Activation:
-
Increases energy expenditure and basal metabolic rate
-
Promotes fatty acid oxidation and hepatic fat breakdown
-
Reduces liver fat accumulation
Dual Synergy:
-
The combination produces greater weight loss than GLP-1 monotherapy by reducing energy intake while increasing energy expenditure
-
Activates multiple signaling pathways including cAMP signaling (hsa04024) and insulin secretion pathways (hsa04911)
Key Research Applications:
-
Metabolic regulation and energy homeostasis studies
-
Adipose tissue metabolism and hepatic steatosis research
-
Glucose metabolism and insulin sensitivity investigations
-
Cardiometabolic risk factor research
-
GLP-1/glucagon receptor co-agonism pharmacology
Product Specifications
| Parameter | Specification |
|---|---|
| Product Name | Mazdutide |
| Synonyms | IBI-362, LY-3305677, OXM-3 |
| CAS Number | 2259884-03-0 |
| Molecular Formula | C₂₁₀H₃₂₂N₄₆O₆₇ |
| Molecular Weight | ~4563.07 g/mol (or ~3142.6 Da for variant) |
| Sequence (One Letter) | HXQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG |
| Type | Modified Peptide / Oxyntomodulin Analog |
| Purity | ≥99% (HPLC Verified) |
| Form | White to off-white lyophilized powder |
| Endotoxin Level | <0.25 EU/mg |
| Storage | -20°C (long-term); -80°C for extended storage; protected from light, desiccated |
| Solubility | Soluble in water; pH adjustment to 2 with HCl |
| Shipping | On dry ice |
Research Background
Clinical Trial Evidence
Phase III GLORY-1 Trial Results :
| Parameter | Mazdutide 4mg | Mazdutide 6mg | Placebo |
|---|---|---|---|
| Weight Loss (48 weeks) | ~12% | ~14.8% | ~0.5% |
| Waist Circumference Reduction | -9.48 cm | -10.96 cm | -1.48 cm |
| Participants Achieving ≥15% Weight Loss | ~50% | ~50% | Low |
Meta-Analysis Data :
-
Weight Loss: Mean reduction of -12.42% body weight (95% CI: -16.15% to -8.68%)
-
Absolute Weight Loss: -9.76 kg (95% CI: -13.15 to -6.37 kg)
-
HbA1c Reduction: -0.63% (95% CI: -0.82 to -0.44) in T2DM patients
-
Systolic Blood Pressure: -7.68 mmHg reduction
-
LDL Cholesterol: -0.37 mmol/L reduction
Liver Fat Reduction:
-
Mazdutide 6mg demonstrated an 80.2% reduction in liver fat content in participants with elevated liver fat at baseline, compared to only 5.3% reduction with placebo .
Safety Profile
The most common adverse events are gastrointestinal side-effects, including nausea, vomiting, and diarrhea, which are typically mild to moderate and occur during dose escalation phases . Serious adverse events are rare, and discontinuation rates due to adverse events are low (1.5% for 4mg, 0.5% for 6mg, vs. 1% for placebo) .
Storage & Reconstitution Guidelines
Storage Conditions:
-
Lyophilized (Long-term): -20°C (or -80°C for extended storage), protected from light, desiccated, inert gas charged
-
Lyophilized (Short-term): 2°C – 8°C (refrigerated)
-
Reconstituted: 4°C for up to 7 days; aliquot for extended storage; avoid repeated freeze-thaw cycles
Reconstitution Protocol:
-
Allow vial to reach room temperature
-
Add sterile bacteriostatic water (ultrasonic and adjust pH to 2 with HCl may be needed for complete dissolution)
-
Gently swirl (do not vortex) until fully dissolved
-
Dispense into individual aliquots to minimize freeze-thaw degradation
Note: Peptides are sensitive to formulation, process, and environmental conditions that may lead to aggregation and degradation.
Important Notice
⚠️ FOR RESEARCH USE ONLY
This product is not intended for human consumption, diagnostic use, therapeutic application, or clinical administration. Mazdutide is a research chemical intended exclusively for in-vitro and laboratory research purposes.
-
Not a dietary supplement, food additive, or pharmaceutical for over-the-counter purchase
-
Not approved by the FDA for human use outside of regulated prescription settings (approved in China for clinical use)
-
Intended solely for qualified researchers and scientific institutions
By purchasing this product, you confirm that you are a licensed researcher or laboratory professional and agree to use this compound in compliance with all applicable local, national, and international regulations.
Why Choose PeptidesUnit.com?
| Feature | Benefit |
|---|---|
| ✅ Premium Purity | ≥99% HPLC-verified purity guaranteed |
| ✅ Research-Grade Quality | Manufactured under GMP-aligned conditions |
| ✅ Third-Party Tested | Independent COA for every batch |
| ✅ Secure Packaging | Lyophilized in amber glass vials with tamper-evident seals |
| ✅ Fast Global Shipping | Discreet packaging with real-time tracking |
| ✅ Competitive Pricing | Direct-from-manufacturer pricing |
Order Now
Mazdutide Peptide 5mg – ≥99% Purity
Available for immediate shipment






Reviews
There are no reviews yet